PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 379aa    MW: 41010.8 Da    PI: 8.7815
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037560genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.23.8e-13120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
      Lus10037560 120 PWTEEEHRLFLIGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY 164
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.109.2E-4322IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.833113169IPR017930Myb domain
SuperFamilySSF466897.33E-17115170IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-19116168IPR006447Myb domain, plants
SMARTSM007175.5E-10117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-11117163IPR009057Homeodomain-like
PfamPF002499.5E-11120164IPR001005SANT/Myb domain
CDDcd001674.30E-9120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MMTRRCSHCS NNGHNSRTCP TRSAAPTGGG GGAGGPSSLS GVKLFGVRLT DGSIIKKSAS  60
MGNLSAHYHS SSPAASPNPD SPVSDHARDS GRLADGYLSD DPAHASSSSN RRGDRKKGVP  120
WTEEEHRLFL IGLQKLGKGD WRGIARNYVV SRTPTQVASH AQKYFIRQNN ATRRKRRSSL  180
FDMVTDSASD PPHSVPEEKE LLSLQAKESN KADNHPSLNL SLKPDYEPME TTSEEPAKEE  240
EEADETTMQS NESLPHVPRP TQFTLLAPSQ NSEFTPFVHQ FVPAYVPVPY PFWPANPVPV  300
KQTVVTETSN HQVLRPVAVI PKQPVNVDEL VGISNLSIGD PSPLSLKLTL ETSRHSAFHA  360
NAAPVSRPEI GKGKIQAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069084.11e-163PREDICTED: myb-like protein H
TrEMBLA0A067KXJ71e-163A0A067KXJ7_JATCU; Uncharacterized protein
STRINGGLYMA13G43120.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.12e-73MYB_related family protein